PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00109.56
Common NameAMTR_s00109p00072520
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family HD-ZIP
Protein Properties Length: 752aa    MW: 83995.2 Da    PI: 6.7879
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00109.56genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox672.4e-2199154156
                                              TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                                 Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                              r+k +++t+eq++e+e+lF+ +++p++++r++L+k+lgL  rqVk+WFqNrR++ k
  evm_27.model.AmTr_v1.0_scaffold00109.56  99 RKKYHRHTAEQIREMEALFKDSPHPDEKQRQQLSKQLGLAPRQVKFWFQNRRTQIK 154
                                              7999************************************************9877 PP

2START208.23.2e-652744915206
                                              HHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS........SCEEEEEEEECCSCHHHHHHH CS
                                    START   5 eaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.......dsgealrasgvvdmvlallve 63 
                                               a+ el+k+a+ +ep+Wv+s     +++n+de+l++f+++++       +s+ea+r+sgvv+m+l+ lv+
  evm_27.model.AmTr_v1.0_scaffold00109.56 274 NAMSELIKMATKGEPLWVRSFetgrDILNYDEYLKEFPSNENssedrerRSVEASRESGVVFMELPSLVQ 343
                                              6899*****************9***************99999**************************** PP

                                              HHCCCGGCT-TT-S....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS- CS
                                    START  64 ellddkeqWdetla....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagd 122
                                               ++d++ qW+e++     ka+t++v+ssg      ga+qlm+ae q+l+plv  R+++fvR++r++++++
  evm_27.model.AmTr_v1.0_scaffold00109.56 344 AFMDVN-QWKEMFSgmisKAATVDVVSSGegstknGAIQLMFAEVQMLTPLVGtREVYFVRHCRKESEDT 412
                                              ******.*************************************************************** PP

                                              EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHH CS
                                    START 123 wvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlphwllrslvksglaeg 192
                                              w+i+dvS+d  +      s+ +++++ Sg+li++ksnghskvtwveh+++++  +h+l+r +v+sgla+g
  evm_27.model.AmTr_v1.0_scaffold00109.56 413 WAILDVSIDTIDA-----SFDKCRKRASGCLIQDKSNGHSKVTWVEHIECNKVAVHSLYRTVVNSGLAFG 477
                                              *********8877.....467************************************************* PP

                                              HHHHHHHTXXXXXX CS
                                    START 193 aktwvatlqrqcek 206
                                              ak+w+atlq qce+
  evm_27.model.AmTr_v1.0_scaffold00109.56 478 AKHWMATLQLQCER 491
                                              ************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.2E-2284150IPR009057Homeodomain-like
SuperFamilySSF466892.17E-1992157IPR009057Homeodomain-like
PROSITE profilePS5007118.09196156IPR001356Homeobox domain
SMARTSM003896.1E-1998160IPR001356Homeobox domain
PfamPF000461.3E-1899154IPR001356Homeobox domain
CDDcd000861.25E-16103154No hitNo description
PROSITE patternPS000270131154IPR017970Homeobox, conserved site
PROSITE profilePS5084837.345261494IPR002913START domain
SuperFamilySSF559613.16E-29264491No hitNo description
CDDcd088754.74E-103265490No hitNo description
SMARTSM002346.4E-66270491IPR002913START domain
PfamPF018523.6E-53274491IPR002913START domain
SuperFamilySSF559613.43E-11513716No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010062Biological Processnegative regulation of trichoblast fate specification
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 752 aa     Download sequence    Send to blast
MPLKSHKPLP PPQPRLFPAK MPESSDHAME NTAVSRTKDF FSSPALSLTL AGVFREREVR  60
EEAGEEAEMS SENADMEEEE EEEEEEEEEE EGGKKKRKRK KYHRHTAEQI REMEALFKDS  120
PHPDEKQRQQ LSKQLGLAPR QVKFWFQNRR TQIKAIQERH ENSLLKTEME KLKEENRKMR  180
EIIKKGACPN CGFATGSRDT VITTEEQQLR IENARLKVEV DKLRRLAGKF PNETASPSSS  240
CSGGTEPERA ILSQDYYTGF FRLEKSKIGK TVNNAMSELI KMATKGEPLW VRSFETGRDI  300
LNYDEYLKEF PSNENSSEDR ERRSVEASRE SGVVFMELPS LVQAFMDVNQ WKEMFSGMIS  360
KAATVDVVSS GEGSTKNGAI QLMFAEVQML TPLVGTREVY FVRHCRKESE DTWAILDVSI  420
DTIDASFDKC RKRASGCLIQ DKSNGHSKVT WVEHIECNKV AVHSLYRTVV NSGLAFGAKH  480
WMATLQLQCE RLVFFMATNV PTKDSSGVTT LAGRKSILKL AQRMTSSFCR GLGASSLNSW  540
TKLSKGGPND IRATSRKNVN DPGEPQGLIL SAVASVWLPV SPTVLFDFLR DDARRKEWDI  600
MSSSPIQPIA NIAKGQDRGN SVALHATQTK ESSVWILQDC STNSYESMMV YAPVDIVGMQ  660
SVMSGCDSSN LPILPSGFSV VSDGMESRPL VITSRPKNRA SEGGSLLTIA FQILANTSPS  720
AKVSMESVES VNSLLSCTLQ KIRTSLQCED A*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19499KKRKRK
294100KKRKRKK
396100RKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011620592.10.0PREDICTED: homeobox-leucine zipper protein GLABRA 2
SwissprotP466070.0HGL2_ARATH; Homeobox-leucine zipper protein GLABRA 2
TrEMBLW1NRU50.0W1NRU5_AMBTC; Uncharacterized protein
STRINGVIT_09s0002g04340.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9080913
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79840.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]